DPCstruct | MC519
Metacluster Properties and Pfam Annotations
| Number of structural domains | 59 |
|---|---|
| Mean domain length (aa) | 175 ± 46 aa |
| Standard deviation of domain lengths | 45.69 |
| Length coefficient of variation | 0.26 |
| Mean AlphaFold2 pLDDT confidence score | 78.72 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.74 |
| Mean intra-cluster local Distance Difference Test score | 0.70 |
| Mean intra-cluster sequence similarity (%) | 35.57 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A251SNY9 | 15-139 | RDYLKFAAEEFGKDHREIYKWLPTADLKKVAQFGCPSLGRKNVFSAKTMRFCFGIREETVCNKCVLKESCKFANQSVWKKGAKNMDL… |
| A0A835CDA7 | 42-215 | QKEPMVLKELSPYMTIVVHHLYKEGYFNFANFAKGERFDLSWFDTEYARKYILFAVQKFGKDKQEISKWLSGSDLKQVAMFGCPSFN… |
| A0A835IKB5 | 39-210 | None |
| A0A067KT00 | 13-168 | None |
| A0A1D6GJL9 | 44-311 | None |
| A0A843WP37 | 82-313 | None |
| W1NK45 | 23-154 | None |
| A0A1U8EFU3 | 322-503 | None |
| A0A835P948 | 56-243 | None |
| A0A540KS28 | 302-492 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.