DPCstruct | MC51895
Metacluster Properties and Pfam Annotations
| Number of structural domains | 18 |
|---|---|
| Mean domain length (aa) | 110 ± 19 aa |
| Standard deviation of domain lengths | 19.04 |
| Length coefficient of variation | 0.17 |
| Mean AlphaFold2 pLDDT confidence score | 76.71 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.73 |
| Mean intra-cluster local Distance Difference Test score | 0.78 |
| Mean intra-cluster sequence similarity (%) | 41.52 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1I7W274 | 1-94 | MASSADAVTKIYVCATMWHETAIEMTCMLKSIFRLDEDQCARRNAQKYLKIIDPDYYEFEAHIFFDDAFDINEYGEPVINKFVQQLV… |
| A0A819F4B3 | 1-130 | NERDEILAGTYDEMGTTINGETEFDEQSIEELSIEKKLTAEVHTKIYSCATMWHGTETEMLQLLKSIMRLDSDQCARRTARNYLHLK… |
| J9DYW1 | 1-97 | None |
| A0A182T4V4 | 385-518 | None |
| A0A7R9JHI4 | 18-119 | None |
| W2SVJ2 | 159-252 | None |
| A0A3B3YHD5 | 329-414 | None |
| A0A498MAD2 | 343-428 | None |
| A0A820Y8V2 | 314-433 | None |
| A0A817R7J2 | 764-893 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.