DPCstruct | MC5189
Metacluster Properties and Pfam Annotations
| Number of structural domains | 3401 |
|---|---|
| Mean domain length (aa) | 171 ± 34 aa |
| Standard deviation of domain lengths | 34.25 |
| Length coefficient of variation | 0.20 |
| Mean AlphaFold2 pLDDT confidence score | 74.14 |
| Mean fraction of residues predicted as intrinsically disordered | 0.26 |
| Mean length-normalized TM-Score | 0.34 |
| Mean intra-cluster local Distance Difference Test score | 0.51 |
| Mean intra-cluster sequence similarity (%) | 16.47 |
| Pfam Score | 97.06 |
| Assigned Pfam label(s) | PF16648- CL0113- CL0110- PF14753- CL0003 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A812PYA4 | 157-328 | GKSSAITFEAMQLDLEGAEEAAFTAAFKSLSSGQAVLQPDHDQLRNFILVNSGVSEQDLDTELLKIASGREDFCVDVQGFITLLREH… |
| A0A3P9QJY3 | 15-168 | NIVSMEEYFFLVAVILRDAFNEFDKDKDGLISCKDLGNLMRTMGYMPTEMELIELSQNINMNLGGRVDFEDFVELMAPKLLAETAGM… |
| A0A7M3RKZ4 | 212-426 | None |
| A0A7S2N419 | 35-242 | None |
| A0A7S2JKE8 | 81-227 | None |
| A0A7S2JK25 | 20-207 | None |
| A0A7M3RWW6 | 40-149 | None |
| A0A397FL41 | 567-767 | None |
| A0A1D2NEQ2 | 14-191 | None |
| A0A7S2NKV4 | 106-258 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.