DPCstruct | MC51884
Metacluster Properties and Pfam Annotations
| Number of structural domains | 29 |
|---|---|
| Mean domain length (aa) | 84 ± 7 aa |
| Standard deviation of domain lengths | 6.60 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 92.82 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.94 |
| Mean intra-cluster local Distance Difference Test score | 0.91 |
| Mean intra-cluster sequence similarity (%) | 47.16 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0016 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A183R5T0 | 58-141 | ADPFYWAWLPMAKEPFSDAIKEAVLPLLSDMHFINSLVRDLHNLFKIDPGFDLSTFHKQMSVLRGQVVNLVAALRDSKSPYDLV |
| A0A6G0UQC5 | 197-279 | PYRWATLPIAKLPFSEEIIEKILPLLDNTDFVRELGNDLKRIFETDPGFDKKLFAKQLSVMRGQIFNLREALRTKKSPAQLVM |
| A0A1B0AIN9 | 2-82 | None |
| A0A0M3J4Z5 | 170-259 | None |
| A0A0V0RPC0 | 304-383 | None |
| G3I843 | 97-178 | None |
| S4RF32 | 222-302 | None |
| A0A0L8VMZ1 | 48-132 | None |
| A0A0N4XXX2 | 15-90 | None |
| A0A183KKI2 | 1-74 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.