DPCstruct | MC51882
Metacluster Properties and Pfam Annotations
| Number of structural domains | 30 |
|---|---|
| Mean domain length (aa) | 223 ± 27 aa |
| Standard deviation of domain lengths | 26.84 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 73.04 |
| Mean fraction of residues predicted as intrinsically disordered | 0.29 |
| Mean length-normalized TM-Score | 0.66 |
| Mean intra-cluster local Distance Difference Test score | 0.70 |
| Mean intra-cluster sequence similarity (%) | 29.93 |
| Pfam Score | 96.15 |
| Assigned Pfam label(s) | CL0020- PF12842 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A183R3J7 | 56-312 | IEPAVLRAINELTTPVFERCARITVTTVVAIVRKDFALDPDPSRMLYAACQMIRHLAAGMSLITAREALGMSLVTSLKNIILTEVQS… |
| A0A0M3J8Q6 | 1-183 | LDPEEQGLRRATHHMIRAMTAGMAAITCRDPLSTTLQGYLKQAFINSLHGVSIGPEQHKLIDEASLTIAEDNVELATNFIVKSACEK… |
| A0A820WC83 | 353-593 | None |
| A0A820WJY6 | 96-286 | None |
| A0A2P2MSE1 | 2-177 | None |
| J9DV94 | 2-197 | None |
| R0MH38 | 252-450 | None |
| A0A817B883 | 70-282 | None |
| A0A1D6PMI2 | 338-550 | None |
| A0A1D6PMF5 | 2-210 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.