DPCstruct | MC5188
Metacluster Properties and Pfam Annotations
| Number of structural domains | 76 |
|---|---|
| Mean domain length (aa) | 123 ± 20 aa |
| Standard deviation of domain lengths | 20.48 |
| Length coefficient of variation | 0.17 |
| Mean AlphaFold2 pLDDT confidence score | 87.45 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.82 |
| Mean intra-cluster local Distance Difference Test score | 0.79 |
| Mean intra-cluster sequence similarity (%) | 34.76 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0014 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0E9WRE7 | 17-105 | NITGNFHHYGVTEKDFRGNEKLETFFSILSTNVAENGAEFVSTMEGRKYPFYGVQWHPEVNRFQWDPKLQFPHSKNAVRVSSLLAEF… |
| A0A3P9QEH1 | 137-247 | YNTDEDLKSFYKVLSTNTDGNTEFVSTVEAYRFPVYGTQWHPEKNAFEWSRPYIPHSPSAVRTTFYTAHFFVSEARKNFHRFQSEEE… |
| A0A5J5CHS6 | 194-347 | None |
| A0A1A8GTF4 | 1-86 | None |
| A0A6G0XKH1 | 86-213 | None |
| A0A7S3J8Q6 | 66-188 | None |
| A0A1D2NLN2 | 198-360 | None |
| A0A3Q0IW23 | 375-484 | None |
| A0A7S1FKV4 | 223-348 | None |
| A0A1D6N117 | 88-222 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.