DPCstruct | MC51879
Metacluster Properties and Pfam Annotations
| Number of structural domains | 16 |
|---|---|
| Mean domain length (aa) | 112 ± 13 aa |
| Standard deviation of domain lengths | 13.24 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 90.04 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.87 |
| Mean intra-cluster local Distance Difference Test score | 0.85 |
| Mean intra-cluster sequence similarity (%) | 41.23 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0479 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| J9APQ7 | 132-237 | QVKELGVAVFNCERLAEDLMKVMNVYWEMGAPGKKLPSSWPNELATPYNAKNSMVVTLNGEQNNVYISSAPPAFCPRGRMDDLSAIL… |
| A0A1D1VAF6 | 340-448 | EVKELGLAGINCSCMAQDLAKVFSVYWYLGEEPQKPVPPHWPTAYSTHINRTNPLSLFYNNSKTPSLVYMASSPPPFSANGRNSDID… |
| A0A667I3R6 | 466-568 | None |
| S7NU96 | 1-93 | None |
| S9WPZ2 | 16-151 | None |
| A0A4W6F987 | 58-164 | None |
| A0A498NT72 | 326-429 | None |
| A0A0R3Q4J5 | 312-426 | None |
| A0A482X677 | 136-248 | None |
| A0A1V4KDQ3 | 388-514 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.