DPCstruct | MC51856
Metacluster Properties and Pfam Annotations
| Number of structural domains | 9 |
|---|---|
| Mean domain length (aa) | 215 ± 8 aa |
| Standard deviation of domain lengths | 8.36 |
| Length coefficient of variation | 0.04 |
| Mean AlphaFold2 pLDDT confidence score | 88.66 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.79 |
| Mean intra-cluster local Distance Difference Test score | 0.71 |
| Mean intra-cluster sequence similarity (%) | 22.92 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0401 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6D0F824 | 231-427 | YFPENLMGKDLVDYLSGAIQGGEADNATLVYGGNPQLFPYKHNEGQFEVLVPLRNAKFAFQPDWPALTNLDIELDFINDGLWMKTDG… |
| A0A1U9JYZ6 | 3-212 | AGQASEAVLRWQGRLDQYPYKDPAQGLFYVGAAIEDATVDYYPAQGAEKGWPKVEKVAGALSIVGNQLRLQSATGNIKPNGKDVVLA… |
| A0A7S9DXL3 | 225-441 | None |
| A0A1P8UIK0 | 396-613 | None |
| A0A1Q7PJS6 | 164-379 | None |
| A0A3S4GZG1 | 1-231 | None |
| A0A3M2D1D7 | 351-564 | None |
| A0A090RVS6 | 34-251 | None |
| A0A7H4GL35 | 483-698 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.