DPCstruct | MC51853
Metacluster Properties and Pfam Annotations
| Number of structural domains | 15 |
|---|---|
| Mean domain length (aa) | 213 ± 38 aa |
| Standard deviation of domain lengths | 37.85 |
| Length coefficient of variation | 0.18 |
| Mean AlphaFold2 pLDDT confidence score | 89.78 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.73 |
| Mean intra-cluster local Distance Difference Test score | 0.65 |
| Mean intra-cluster sequence similarity (%) | 21.97 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| F3FET8 | 4-221 | AQILAVKLFKQACSVRLILDPTQLDFHDGSQIVFVDHSSATILARACLETFIVFHWIFQCQDPALRQFRYGVWRLGGLMDRLKLHPS… |
| A0A0Q5IP12 | 13-207 | ASVLFTTLCARGVSLAILAPGTSWSKKVTDHWDYASLAVLVRSLLEVRECRWNIFNLHDCTARIHLFEEMDPNSADIPGFQTQAAEL… |
| A0A072TPK5 | 231-465 | None |
| A0A259F017 | 1-182 | None |
| A0A644TTG2 | 67-307 | None |
| A0A1B7VPS0 | 2-306 | None |
| K2DKN4 | 119-357 | None |
| A0A7Y1AD66 | 39-271 | None |
| A0A3B9L7U1 | 3-239 | None |
| Q5ZSE6 | 32-243 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.