DPCstruct | MC5185
Metacluster Properties and Pfam Annotations
| Number of structural domains | 33 |
|---|---|
| Mean domain length (aa) | 107 ± 23 aa |
| Standard deviation of domain lengths | 22.84 |
| Length coefficient of variation | 0.21 |
| Mean AlphaFold2 pLDDT confidence score | 88.81 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.85 |
| Mean intra-cluster local Distance Difference Test score | 0.79 |
| Mean intra-cluster sequence similarity (%) | 37.49 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0286 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A150LX02 | 2-112 | LASKETLIKKAMSIERELVVLTENDEISFSFWNATLNADEVQTYITLAKQMAEHAKAQKRVLRNEKPADNEKYAFRCFLLRLGFIGD… |
| A0A3D4QU95 | 198-283 | QKGTIEFRMFNGTTHAGKIKAYIQFCLAISHQAMTQRSASKQKTVTSNDKYTFRTWLLRLGLIGDEFKTARLHLLANLEGNIAWLN |
| A0A3A9ENU3 | 20-134 | None |
| A0A645HGI7 | 87-210 | None |
| A0A413QAJ0 | 188-280 | None |
| A0A645CAG1 | 67-181 | None |
| A0A644Y7Z4 | 123-244 | None |
| A0A1V5GAI7 | 16-107 | None |
| A0A7C5BS92 | 19-110 | None |
| A0A7M1QWV2 | 11-141 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.