DPCstruct | MC51848
Metacluster Properties and Pfam Annotations
| Number of structural domains | 13 |
|---|---|
| Mean domain length (aa) | 153 ± 17 aa |
| Standard deviation of domain lengths | 17.28 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 76.64 |
| Mean fraction of residues predicted as intrinsically disordered | 0.27 |
| Mean length-normalized TM-Score | 0.73 |
| Mean intra-cluster local Distance Difference Test score | 0.70 |
| Mean intra-cluster sequence similarity (%) | 45.09 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A4S4E2G3 | 88-244 | KPEDVDMEEEYGLTTHRKLLLTIRCADHSVKPLDEWQLKCSFTDFLKSSFSLTVPEDDIVVRRFKDLKKRKRDDPVTHGVLFIRDLG… |
| B7EG21 | 22-171 | LAPRLKLLLTFFRADLSVRPVDEWQLKTALLAFLRDPPLSLPVLPDSDLSVRTLPDLHKRRRDEPVASGVLHVRDLSFLRPRRRNGD… |
| A0A7J7L8K9 | 12-178 | None |
| A0A5N6Q127 | 86-210 | None |
| A0A022R9G0 | 169-322 | None |
| A0A822ZAF0 | 9-175 | None |
| A0A803LZM9 | 10-156 | None |
| A0A0P0V4R4 | 16-176 | None |
| A0A1B6QF85 | 6-167 | None |
| A0A444G488 | 84-261 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.