DPCstruct | MC51847
Metacluster Properties and Pfam Annotations
| Number of structural domains | 31 |
|---|---|
| Mean domain length (aa) | 197 ± 28 aa |
| Standard deviation of domain lengths | 27.81 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 77.01 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.72 |
| Mean intra-cluster local Distance Difference Test score | 0.72 |
| Mean intra-cluster sequence similarity (%) | 36.88 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A4S4E0X2 | 36-226 | KKKSSDADSPRPVALLSSLANSVVYRCSKILLIPTEELQHRFETELPDAVKQPSTYTRNFLGFCSYQALNLVTAHPDYLSDKEFRCL… |
| Q5N949 | 108-285 | TVERRVGRGWLSLDAVVTIEQFARLNGLTGRKVQRIFEALAPSHVQNDARNLVEYCCFRYLSRDNSDLHPSLKELAFQRLIFMTMLA… |
| A0A6A3B1U8 | 63-227 | None |
| A0A835JRZ9 | 519-732 | None |
| A0A4Y7JA98 | 49-249 | None |
| F6GTL6 | 73-273 | None |
| A0A811M629 | 29-263 | None |
| A0A1U7Y7I3 | 1-225 | None |
| A0A834ZCV6 | 17-181 | None |
| A0A1D6Q5P6 | 51-279 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.