DPCstruct | MC51846
Metacluster Properties and Pfam Annotations
| Number of structural domains | 14 |
|---|---|
| Mean domain length (aa) | 129 ± 18 aa |
| Standard deviation of domain lengths | 18.06 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 71.06 |
| Mean fraction of residues predicted as intrinsically disordered | 0.33 |
| Mean length-normalized TM-Score | 0.69 |
| Mean intra-cluster local Distance Difference Test score | 0.84 |
| Mean intra-cluster sequence similarity (%) | 44.66 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF05755 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A4S4DRT2 | 1-120 | MADTEAKQPTETIQDDENRLKYLDFVLVAAIYVIICFSILYEYAKKNSGPLKPRVQIVEGTVKTVIGPVYEKFHDILFELLKFIDCK… |
| A0A2K1XUY8 | 1-103 | MAKLEPKQRTEMTRRKKLKYVDFVQVVPIYVVVCFSSVYRYAKENSGPLKPGVRTVEDTVRTVIGPVHDKFHDVPFQLLKFVDHKID… |
| A0A4S8J6K3 | 98-242 | None |
| A0A446KMX7 | 1-94 | None |
| A0A2G3B8W9 | 1-103 | None |
| M9PNQ7 | 1-127 | None |
| A0A6V7PR89 | 1-151 | None |
| A0A816LHQ2 | 1-156 | None |
| A9NNP5 | 9-146 | None |
| A0A4D9B8R3 | 1-125 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.