DPCstruct | MC51836
Metacluster Properties and Pfam Annotations
| Number of structural domains | 2421 |
|---|---|
| Mean domain length (aa) | 117 ± 22 aa |
| Standard deviation of domain lengths | 22.26 |
| Length coefficient of variation | 0.19 |
| Mean AlphaFold2 pLDDT confidence score | 75.79 |
| Mean fraction of residues predicted as intrinsically disordered | 0.31 |
| Mean length-normalized TM-Score | 0.61 |
| Mean intra-cluster local Distance Difference Test score | 0.61 |
| Mean intra-cluster sequence similarity (%) | 18.76 |
| Pfam Score | 95.73 |
| Assigned Pfam label(s) | PF02377- PF16599- CL0020- CL0466- PF10152 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A672I1Y1 | 6-123 | VSPHHKDLQMIELEKDPAAHGLGISLTGNKDGSRARMSVNDTGIFVSDIIRGGVADSDGRLLLGDQILSINGEDVRAASQEHAKTLL… |
| A0A2H8TNS9 | 63-152 | RDRPLERTINLYKDRVGQIGFQFKNGKINNIVKDSSAARNGVLTDHQLLEINGQNVIGMKDKQIVDIIANAADSISITIIPVTIYDH… |
| A0A6S8SKV9 | 8-136 | None |
| A0A7S4NDN0 | 415-531 | None |
| A0A7S1XUN2 | 39-143 | None |
| A0A6S8UPM6 | 178-297 | None |
| A0A7R9LLI3 | 138-239 | None |
| A0A6S8RT44 | 19-118 | None |
| A0A6S8UJX8 | 40-169 | None |
| A0A1B0BGX1 | 40-147 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.