DPCstruct | MC51833
Metacluster Properties and Pfam Annotations
| Number of structural domains | 117 |
|---|---|
| Mean domain length (aa) | 220 ± 41 aa |
| Standard deviation of domain lengths | 40.62 |
| Length coefficient of variation | 0.18 |
| Mean AlphaFold2 pLDDT confidence score | 87.44 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.69 |
| Mean intra-cluster local Distance Difference Test score | 0.68 |
| Mean intra-cluster sequence similarity (%) | 27.25 |
| Pfam Score | 84.91 |
| Assigned Pfam label(s) | PF00317- CL0339 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0G1HZE4 | 93-360 | TDIVVSKYFRGQLNTPAREQSVRQMIDRVAQTVARWGLAGGYFISAGDAERYAEDLTWLLVNQYASFNSPVWFNVGIYEKPQCSACF… |
| A0A243A247 | 81-231 | FEFQSYMAASKFYKDYALKTNDQKQYLESYEDRVAIVSLYLGRGDVAKAKHFASMIVKQNYQPATPTFLNAGRSRRGEMVSCFLLEM… |
| A0A655F9P8 | 4-184 | None |
| A0A017HT65 | 224-437 | None |
| A0A1F9H5F3 | 106-404 | None |
| A0A340XZ70 | 2-230 | None |
| A0A5P1FAL9 | 22-178 | None |
| A0A662QK70 | 26-267 | None |
| A0A0P9AZG8 | 46-249 | None |
| A0A0N5D713 | 126-377 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.