DPCstruct | MC51830
Metacluster Properties and Pfam Annotations
| Number of structural domains | 16 |
|---|---|
| Mean domain length (aa) | 160 ± 10 aa |
| Standard deviation of domain lengths | 9.91 |
| Length coefficient of variation | 0.06 |
| Mean AlphaFold2 pLDDT confidence score | 90.87 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.75 |
| Mean intra-cluster local Distance Difference Test score | 0.64 |
| Mean intra-cluster sequence similarity (%) | 22.21 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A3P1Y3Y8 | 29-182 | AALPRDYREFKARYQKEGRTPEGAVKLYFEAVFCYIDEATRDEGSKMLRYALHSSLPIERSHTLGTFVERLRDPDKQHIFRSFAAGA… |
| A0A2N0BP88 | 2-145 | VSLIAALHLYSKNKEEGIKALILVVDSSHLNEDSKGYKGFSLSRNLVDLIKRQIEQHPYLIGSYLPGSSASNGYIPGPPPYSFTLSS… |
| A0A3D0N2I9 | 185-360 | None |
| A0A1V5GNJ0 | 115-277 | None |
| A0A413K8F3 | 34-190 | None |
| A0A2D4SPS8 | 73-222 | None |
| A0A0X8JRP3 | 98-258 | None |
| A0A6L5XDC3 | 112-263 | None |
| A0A7K4D1E0 | 4-164 | None |
| A0A7C6TPF6 | 115-268 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.