DPCstruct | MC5183
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 142 ± 10 aa |
| Standard deviation of domain lengths | 10.38 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 81.63 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.72 |
| Mean intra-cluster local Distance Difference Test score | 0.69 |
| Mean intra-cluster sequence similarity (%) | 29.44 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0Q7D3U6 | 4-138 | ALKVEAAVVDQIAAVPVSAEAEAAFEAQRDLDSEGAEALWGLDVGVASAVIALSALRAMPFISCNAGSFGGVHAASRPYVAFYIAEA… |
| A0A2W6CDA8 | 44-196 | CVEAEARWLDRAAKASTAEEFDRILSTAAAEEAPDDFDWLFRGLDVGVAGLTLVLSAAYYATCFSCRTHPSISGDHMPQVIMAAEPQ… |
| A0A536DP02 | 31-164 | None |
| A0A3D2W1D3 | 52-188 | None |
| A0A7W9FFM8 | 133-266 | None |
| A0A0F7FVI4 | 2-142 | None |
| V7F3L0 | 38-164 | None |
| E3IVZ9 | 67-226 | None |
| E4NDT6 | 1-156 | None |
| A0A0Q8UMI9 | 42-186 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.