DPCstruct | MC51822
Metacluster Properties and Pfam Annotations
| Number of structural domains | 40 |
|---|---|
| Mean domain length (aa) | 311 ± 53 aa |
| Standard deviation of domain lengths | 52.80 |
| Length coefficient of variation | 0.17 |
| Mean AlphaFold2 pLDDT confidence score | 81.88 |
| Mean fraction of residues predicted as intrinsically disordered | 0.27 |
| Mean length-normalized TM-Score | 0.64 |
| Mean intra-cluster local Distance Difference Test score | 0.66 |
| Mean intra-cluster sequence similarity (%) | 33.02 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A3E1NF48 | 53-373 | EEGRVRVLWDGTGNATGYAYDYFLKDHLGNVRTVFIDEKNSQRYLATVEPQYRTTEQKLFSNQLIQTTRSKSEIPGFDNDPNNTAIT… |
| A0A1V9FU76 | 27-368 | DYFAKDHLGNVRMVLTDQKDTAKYLASMEPNYRAKEDALFNNVTLTACSTAVVPGGYPVDTSITNPNEWVSWVNGSGNKIGPSLTLR… |
| A2A0D9 | 11-298 | None |
| A0A2T7QEM5 | 36-346 | None |
| A2A0G4 | 7-291 | None |
| A0A4V4H1A9 | 522-899 | None |
| A0A514CLE6 | 16-268 | None |
| A0A2T7Q3Y3 | 3-381 | None |
| A0A2T7Q8W4 | 9-303 | None |
| A0A355BRP9 | 1-305 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.