DPCstruct | MC51816
Metacluster Properties and Pfam Annotations
| Number of structural domains | 1222 |
|---|---|
| Mean domain length (aa) | 292 ± 64 aa |
| Standard deviation of domain lengths | 63.79 |
| Length coefficient of variation | 0.22 |
| Mean AlphaFold2 pLDDT confidence score | 85.14 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.44 |
| Mean intra-cluster local Distance Difference Test score | 0.43 |
| Mean intra-cluster sequence similarity (%) | 12.22 |
| Pfam Score | 85.72 |
| Assigned Pfam label(s) | CL0270- CL0142- PF02729- CL0063- CL0304 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A415HRK0 | 51-349 | NDKLRIACEIGSGEDIRFKVLKRNLKILEKLTGIEFVDMADAEFGSSNEASVYYVEYAINEGVDGILLSPSSDQILPTVCRLCQDAG… |
| A0A7J2JS27 | 2-242 | EYDLIIGVGFLLTDAIHQVAQEYPNQWFAIVDSVTPDPNVRGILFKENEGSALVGILAAYVTENNKVGVVLGMEIPVLYHFEAGFYW… |
| A0A378N7X8 | 172-422 | None |
| A0A5C4MDG9 | 15-292 | None |
| A0A534KFU6 | 146-496 | None |
| A0A399ZJI7 | 29-365 | None |
| A0A0S6VV34 | 22-305 | None |
| A0A0S6VT71 | 515-774 | None |
| A0A061RDJ9 | 34-413 | None |
| H1LDU1 | 72-280 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.