DPCstruct | MC51808
Metacluster Properties and Pfam Annotations
| Number of structural domains | 39 |
|---|---|
| Mean domain length (aa) | 218 ± 50 aa |
| Standard deviation of domain lengths | 50.20 |
| Length coefficient of variation | 0.23 |
| Mean AlphaFold2 pLDDT confidence score | 82.33 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.67 |
| Mean intra-cluster local Distance Difference Test score | 0.63 |
| Mean intra-cluster sequence similarity (%) | 22.00 |
| Pfam Score | 97.62 |
| Assigned Pfam label(s) | PF20252- PF12165 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A835UG44 | 60-290 | INEDLEGQRARALHYALTDVKCRVAVQLLLIQAAIEIVNMFQGKLSAKNIVILFEGFHGIAIHAHKINSDLELRSRLLDLGPMTQMQ… |
| A0A0A9YPH6 | 1-169 | MYSCLSSHHLMTLVECLLHAHNLAKKFNMNHNQRNLLWKAGIYGKKPDLIAQETASLACAMRILLKMACDEGRRDAWPTVQHTLIEV… |
| A0A834RTE4 | 2-188 | None |
| A0A7S3ZQP3 | 847-1053 | None |
| A0A6J0PET4 | 1015-1264 | None |
| A0A6V7PXN5 | 4-148 | None |
| C1N7R0 | 510-945 | None |
| A0A7S4HFI7 | 15-220 | None |
| A0A6V7NLG1 | 9-201 | None |
| A0A7S2E502 | 3-303 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.