DPCstruct | MC51806
Metacluster Properties and Pfam Annotations
| Number of structural domains | 81 |
|---|---|
| Mean domain length (aa) | 153 ± 28 aa |
| Standard deviation of domain lengths | 28.17 |
| Length coefficient of variation | 0.18 |
| Mean AlphaFold2 pLDDT confidence score | 85.70 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.78 |
| Mean intra-cluster local Distance Difference Test score | 0.79 |
| Mean intra-cluster sequence similarity (%) | 37.30 |
| Pfam Score | 99.32 |
| Assigned Pfam label(s) | CL0492- CL0364 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1R3I4N0 | 15-184 | KKPRRPYEKERLDAELRLVGEYGLRCKRELWRVQYALSRIRNAARELLTLDEKNPRRIFEGEALLRRMNRYGLLDESQNKLDYVLAL… |
| A0A835U996 | 53-194 | MRKLKFHEKKLLKKVNFIEYKREKGHREALITRRYSGICKMVQKLVHILKQMDPRDPFRIEMTDALLEQLYNMGVIPTKKSLVKCEK… |
| A0A7J4F973 | 4-142 | None |
| A0A1Q9CXA4 | 100-273 | None |
| A0A3L6PXY7 | 112-283 | None |
| A0A3F2RQ11 | 15-164 | None |
| A0A2H9PVN7 | 13-166 | None |
| A0A1B0B9V3 | 25-122 | None |
| A0A545UZX0 | 40-208 | None |
| A0A7J6KUK5 | 9-170 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.