DPCstruct | MC51805
Metacluster Properties and Pfam Annotations
| Number of structural domains | 8 |
|---|---|
| Mean domain length (aa) | 147 ± 19 aa |
| Standard deviation of domain lengths | 19.40 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 64.67 |
| Mean fraction of residues predicted as intrinsically disordered | 0.40 |
| Mean length-normalized TM-Score | 0.55 |
| Mean intra-cluster local Distance Difference Test score | 0.78 |
| Mean intra-cluster sequence similarity (%) | 43.25 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0064 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A835SCN5 | 14-175 | PADVLPRNGPIDFLPRAHLGQGVVETVAMITHDKAKKNDSYAVNATKPFQIQDVFSLENEETDGIQLIDQKDNVFVMSNPKSKYPVL… |
| A0A7I8VJ68 | 191-306 | RLAEKQNGPMADHEEAHSLPRLVDAYDNQFVLSRPADTTIPREDHNLLHDLAYLIMLSGIFGWLTHLCGLPTLFGHMAAGVCLGPGG… |
| D7LJK9 | 37-158 | None |
| A0A453SDI6 | 14-174 | None |
| A0A7J0E9Q3 | 1-156 | None |
| A0A1D6P1L3 | 1-171 | None |
| A0A5E4CRS7 | 2-159 | None |
| A0A673GBF3 | 194-325 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.