DPCstruct | MC51804
Metacluster Properties and Pfam Annotations
| Number of structural domains | 36 |
|---|---|
| Mean domain length (aa) | 133 ± 21 aa |
| Standard deviation of domain lengths | 21.02 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 73.48 |
| Mean fraction of residues predicted as intrinsically disordered | 0.28 |
| Mean length-normalized TM-Score | 0.62 |
| Mean intra-cluster local Distance Difference Test score | 0.74 |
| Mean intra-cluster sequence similarity (%) | 33.13 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF02325 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A835S5I0 | 42-183 | RPPGRLPNNVVAYHIIRSIDIVSDIDNQTTPALSEIKWLQSLVMADVDSGTARTLVGIIGPFLSAFGFLFIIRIVMSWYPKIPVEKF… |
| A0A6H1TUB4 | 3-92 | SAAIASWIVGPILLVMTLLFILRIVLTWYPQVELNKLPWNLIAWPTEPFLIPTRKLIPPLGGVDITPILWVGIFSLLRELLLGQQGI… |
| A0A2P5BN48 | 96-209 | None |
| A0A7S2KHM3 | 8-113 | None |
| M1V7G6 | 47-204 | None |
| L1LDK1 | 1-124 | None |
| A0A5B8MTV6 | 97-244 | None |
| R1CC06 | 4-92 | None |
| A0A2D8QHE1 | 1-137 | None |
| C1N2H6 | 71-218 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.