DPCstruct | MC51801
Metacluster Properties and Pfam Annotations
| Number of structural domains | 15 |
|---|---|
| Mean domain length (aa) | 146 ± 24 aa |
| Standard deviation of domain lengths | 23.76 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 81.72 |
| Mean fraction of residues predicted as intrinsically disordered | 0.17 |
| Mean length-normalized TM-Score | 0.86 |
| Mean intra-cluster local Distance Difference Test score | 0.81 |
| Mean intra-cluster sequence similarity (%) | 36.23 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1I8HEH3 | 30-156 | GGFGIERILRTLFVPGLFLLPRFHESVAACMDACPPQVEEVRVNLTEPMLRCQSALVDLLKACMQELARSAPVLDANELTVENALTR… |
| A0A835S1J0 | 1-129 | MVSGFAKAERIMNCLYVWRLNLWPCFHVLVCGDLERDAPQVVDVRVPTTPAMRGIQQVVLETMDAWLKELRKTNKVDVEDLTVENGL… |
| A0A0L7L510 | 4-124 | None |
| A0A3B5L1P1 | 169-360 | None |
| A0A1A9X4N7 | 1-106 | None |
| A0A835U4C5 | 4-129 | None |
| A0A6A6LCN2 | 2-127 | None |
| A0A1B0CZL7 | 106-278 | None |
| A0A820PGE5 | 172-345 | None |
| A0A183E4F1 | 93-250 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.