DPCstruct | MC5180
Metacluster Properties and Pfam Annotations
| Number of structural domains | 31 |
|---|---|
| Mean domain length (aa) | 112 ± 12 aa |
| Standard deviation of domain lengths | 11.60 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 84.79 |
| Mean fraction of residues predicted as intrinsically disordered | 0.24 |
| Mean length-normalized TM-Score | 0.78 |
| Mean intra-cluster local Distance Difference Test score | 0.77 |
| Mean intra-cluster sequence similarity (%) | 41.49 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| F2RWX5 | 28-136 | YSYRQCVAALQAEGVPKDLSSKTARWCVVRGIRTSYEYATSPEVSRICTDMAIPQFARARNARLIMSNIVPEGMEDPRVQPYCIWIP… |
| A0A4S9L8W7 | 1-120 | MTTGNPNAPNDLTKQLCSFKWDEAASKAAIRVEKIPGELDLGLTKLCVVRGVRYHDGFGKEPHGVLPLFTRALNVSSIMSGRISEID… |
| A0A0D2Y8T2 | 269-365 | None |
| A0A1L9VNM6 | 321-440 | None |
| A0A1J7I587 | 8-107 | None |
| A0A1J7JIV6 | 6-107 | None |
| G4UQ13 | 334-450 | None |
| A0A420Y787 | 7-122 | None |
| A0A2L2TJV8 | 2-110 | None |
| A0A1V6YNP7 | 1-116 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.