DPCstruct | MC518
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 268 ± 36 aa |
| Standard deviation of domain lengths | 36.01 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 90.76 |
| Mean fraction of residues predicted as intrinsically disordered | 0.24 |
| Mean length-normalized TM-Score | 0.78 |
| Mean intra-cluster local Distance Difference Test score | 0.64 |
| Mean intra-cluster sequence similarity (%) | 21.35 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF14158 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A3B9ANY4 | 40-289 | VVLAPMALKILQVGVPGWYVLIAALFAISLPLSGPWWLAVPYLTFAAWNVWTALVQLLSVVERPLVGWVRLFALGYWFTGGIWALFH… |
| A0A124DYG1 | 7-220 | TEIPGILSLGWLLFTLLLGIYGLTTIVISKGKAAEIAIGAGLVYFFIGGIWFTLYQYQFDLFQANPATHALSSVHFHFSSAIVPIFI… |
| A0A061NW91 | 32-304 | None |
| A0A7W5YR62 | 6-250 | None |
| A0A6I1FZ65 | 4-257 | None |
| A0A2V9UGL6 | 28-372 | None |
| A0A1S1RM55 | 4-287 | None |
| A0A3M1THT3 | 3-248 | None |
| A0A3D8VPH4 | 2-316 | None |
| R8H1I2 | 37-294 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.