DPCstruct | MC51797
Metacluster Properties and Pfam Annotations
| Number of structural domains | 241 |
|---|---|
| Mean domain length (aa) | 150 ± 27 aa |
| Standard deviation of domain lengths | 27.23 |
| Length coefficient of variation | 0.18 |
| Mean AlphaFold2 pLDDT confidence score | 85.18 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.66 |
| Mean intra-cluster local Distance Difference Test score | 0.56 |
| Mean intra-cluster sequence similarity (%) | 17.67 |
| Pfam Score | 95.51 |
| Assigned Pfam label(s) | CL0126- CL0063- PF01151- PF04073- CL0040 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A440IA41 | 11-133 | AAAQCGCTVAQIVKSMVFQGQASGKLFLFLVSGSNQLDLAKAAALTGEPLERADPRQIRDETGFAIGGVAPIGHLIAIPAFADKTLL… |
| A0A7J3UH03 | 14-151 | IWHKFIDKPETIHTSDAAEKAGIELKRVTKSLVLLDKNKNAILAIIPGNEKLSFSKLKNAVQSKKVRMVAFEDAKKYSGYLPGATPM… |
| A0A539EA14 | 8-162 | None |
| A0A5J6Z3Q5 | 117-227 | None |
| V4C1P3 | 345-501 | None |
| A0A837Q2D4 | 59-194 | None |
| A0A522EN79 | 109-261 | None |
| M2S2W5 | 44-225 | None |
| A0A3S0ZEF7 | 43-234 | None |
| A0A2M7X486 | 12-170 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.