DPCstruct | MC51795
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 73 ± 7 aa |
| Standard deviation of domain lengths | 6.56 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 85.60 |
| Mean fraction of residues predicted as intrinsically disordered | 0.29 |
| Mean length-normalized TM-Score | 0.87 |
| Mean intra-cluster local Distance Difference Test score | 0.86 |
| Mean intra-cluster sequence similarity (%) | 53.36 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2E9Y673 | 3-73 | KPSKNQVSYLTRGLPQPGGKLPLFDDQGQEIDIRTIRACIKAGWAEPWFANPLKPDWLVCRLTDSGREAVA |
| A0A2S6RHM0 | 3-73 | KPTPSQRRWLERGLIQPGGKLPLFDGEGQQISGRTVRACVDHGWAEPWRHNPIKPDWLICRITAEGRAAVG |
| A0A081B9R5 | 52-125 | None |
| A0A2S6S202 | 1-85 | None |
| A0A839STE2 | 10-81 | None |
| A0A4R2PQ47 | 20-90 | None |
| A0A1X7GPB6 | 90-175 | None |
| A0A5M6HQP3 | 3-64 | None |
| A0A2S6QGY4 | 37-106 | None |
| A0A512NEF0 | 30-98 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.