DPCstruct | MC51782
Metacluster Properties and Pfam Annotations
| Number of structural domains | 26 |
|---|---|
| Mean domain length (aa) | 228 ± 39 aa |
| Standard deviation of domain lengths | 38.80 |
| Length coefficient of variation | 0.17 |
| Mean AlphaFold2 pLDDT confidence score | 74.76 |
| Mean fraction of residues predicted as intrinsically disordered | 0.42 |
| Mean length-normalized TM-Score | 0.42 |
| Mean intra-cluster local Distance Difference Test score | 0.74 |
| Mean intra-cluster sequence similarity (%) | 20.04 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF10018 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1E3JUJ9 | 16-236 | PKTSLLQNLTTQSLLLNHLFTLLSSLPSPQTAPQISQVHAALQLSAIDISGLVKGIGRHQEAWSRFMAKKEEVEGLEKRVRSMIRRL… |
| A0A034WP45 | 1-171 | MSFHLSTKERLLLLLDDIELVAKELIENTVAPKHQKISTADHTALVDLLVSKDEEFRKMLELADEQAKIEQKMDELRAKVEVQDREI… |
| A0A226EUI8 | 3-202 | None |
| Q32LT3 | 1-226 | None |
| A0A1E3ND87 | 1-251 | None |
| A0A2P6N1Z4 | 1-168 | None |
| A0A6G0X371 | 2-203 | None |
| A0A815PHY5 | 6-203 | None |
| A0A4S4LYS2 | 107-329 | None |
| W6MNF9 | 2-245 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.