DPCstruct | MC51776
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 191 ± 22 aa |
| Standard deviation of domain lengths | 21.92 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 85.79 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.81 |
| Mean intra-cluster local Distance Difference Test score | 0.71 |
| Mean intra-cluster sequence similarity (%) | 24.73 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A4Y2IZB9 | 3-200 | LIRRSESDFVWRRLSQNLITEMPLSSLESFATNLLLVTPWYGNLEWVLGEEGANNRKLNYIMSTKLLLIRHFKKVIVLQNTIGYFAS… |
| A0A6P7WUN7 | 235-435 | RLTAFTQLDCIWQRMCWRLVESVPDRWMEAVVSGFVQMAPGAVVLCRLLGNLVMKNKKAQFVLTQKMLLLQYGYKTTVLQSLLGYLA… |
| A0A287U7R3 | 15-236 | None |
| A0A1I8H8F7 | 362-535 | None |
| A0A814M947 | 1-166 | None |
| A0A819EHW9 | 596-781 | None |
| A0A7E4RCX4 | 604-828 | None |
| A0A1I7X2P3 | 486-685 | None |
| A0A2D4GFG1 | 1-160 | None |
| A0A2A2LP49 | 688-894 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.