DPCstruct | MC5177
Metacluster Properties and Pfam Annotations
| Number of structural domains | 12 |
|---|---|
| Mean domain length (aa) | 121 ± 11 aa |
| Standard deviation of domain lengths | 10.63 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 67.68 |
| Mean fraction of residues predicted as intrinsically disordered | 0.29 |
| Mean length-normalized TM-Score | 0.52 |
| Mean intra-cluster local Distance Difference Test score | 0.80 |
| Mean intra-cluster sequence similarity (%) | 51.58 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0229 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A453HR77 | 1-124 | LPNRLMVGKETVVKIVEDTFRKMREPANAVSASGNQNELGYSVMPMKNPDDSAQLDIKVRCPCGNSMATGSMIQCDHPRCSVWQHID… |
| A0A2T8KGE9 | 1-116 | MVYKRKKMVEREMAVKIVENTFRKMQEPASNVAVSRSHIESGHSVKSKKKSDDSGELNVKVRCPCGNSKPNDSMIKCVDPQCNIRQH… |
| A0A446U4J9 | 64-183 | None |
| A0A2N9HTV0 | 3-125 | None |
| A0A287R465 | 121-247 | None |
| A0A2G3BBH5 | 184-289 | None |
| A0A287R429 | 164-288 | None |
| A0A059D519 | 11-107 | None |
| M8CFY4 | 36-151 | None |
| A0A3P6BGC0 | 53-177 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.