DPCstruct | MC51758
Metacluster Properties and Pfam Annotations
| Number of structural domains | 54 |
|---|---|
| Mean domain length (aa) | 172 ± 41 aa |
| Standard deviation of domain lengths | 40.55 |
| Length coefficient of variation | 0.24 |
| Mean AlphaFold2 pLDDT confidence score | 89.61 |
| Mean fraction of residues predicted as intrinsically disordered | 0.29 |
| Mean length-normalized TM-Score | 0.74 |
| Mean intra-cluster local Distance Difference Test score | 0.65 |
| Mean intra-cluster sequence similarity (%) | 27.75 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF04417 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7C6ZA39 | 2-181 | ERQIGRKPRGFLRVATRCPFGLPETIVTRPVLREDGGTSPERRVKPFPTVFWLTCPGAVRAVSELEALGYVRELQRRLAGDASAFEA… |
| A0A316JI44 | 4-147 | EDIEEVSRQLGRPARNIVEVSARCVCGRPVVVKTEPRLEDGTPFPTLYYLTQPSATAAVSTLEASGYMARVQQLLEEDTELSARYHS… |
| A0A101HTL2 | 10-165 | None |
| D8LLL9 | 1-163 | None |
| B7FZ01 | 61-309 | None |
| B7FYF2 | 41-285 | None |
| A0A7G1I884 | 6-148 | None |
| C1ECF1 | 54-262 | None |
| A0A6J4J045 | 1-152 | None |
| A0A7S1Q820 | 19-167 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.