DPCstruct | MC51756
Metacluster Properties and Pfam Annotations
| Number of structural domains | 29 |
|---|---|
| Mean domain length (aa) | 138 ± 27 aa |
| Standard deviation of domain lengths | 27.33 |
| Length coefficient of variation | 0.20 |
| Mean AlphaFold2 pLDDT confidence score | 76.91 |
| Mean fraction of residues predicted as intrinsically disordered | 0.50 |
| Mean length-normalized TM-Score | 0.53 |
| Mean intra-cluster local Distance Difference Test score | 0.62 |
| Mean intra-cluster sequence similarity (%) | 19.50 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| V9G486 | 313-457 | VSTTAGGTTSGSEFGSIEQEFEDRTRTMLEQIVGVGAVDVMVTVDSTEEIVVKSNVKDTQELTEETDANGGKRHVTSYQRDGQIVTY… |
| A0A7C6Y825 | 11-138 | ADVERELELILSKVKDVGSVSVMLTYKDSTEYKYAETTEKTQKTTVETDQQGGSREITESQESSQIVLARGSQGGEEAVLLQEIKPN… |
| A0A7W7HK76 | 40-208 | None |
| A0A847CB50 | 2-118 | None |
| A0A3A9FDN2 | 1-214 | None |
| A0A355JCU4 | 22-144 | None |
| A0A7C6ZH63 | 81-238 | None |
| A0A3N5ZSH0 | 28-121 | None |
| R7FJZ1 | 2-117 | None |
| A0A2W5YT35 | 228-372 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.