DPCstruct | MC51753
Metacluster Properties and Pfam Annotations
| Number of structural domains | 6 |
|---|---|
| Mean domain length (aa) | 120 ± 4 aa |
| Standard deviation of domain lengths | 4.03 |
| Length coefficient of variation | 0.03 |
| Mean AlphaFold2 pLDDT confidence score | 71.36 |
| Mean fraction of residues predicted as intrinsically disordered | 0.30 |
| Mean length-normalized TM-Score | 0.55 |
| Mean intra-cluster local Distance Difference Test score | 0.76 |
| Mean intra-cluster sequence similarity (%) | 49.25 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF08499 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A668TV39 | 88-206 | EDDLQQLQSDGVPSEVTDWLASTFTQKIRRPTRRSDEKPKFRSIVHAVQAGIFVERMFKRAYTAAMPDQPAEVVNCLRDVDRWSFDV… |
| A0A4Y2CCB1 | 59-179 | TIDDDDELSEFHPNAVPTEVREWLASTFSKKTATQRKRSEDKPRFRSVANAIRAGIMVDRLYRRMSNSTLFYIPTHISLYLKGLDEY… |
| A0A673K2Y1 | 98-222 | None |
| A0A814LUQ5 | 149-260 | None |
| A0A443R5Z7 | 68-189 | None |
| A0A4U5VST7 | 377-494 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.