DPCstruct | MC51752
Metacluster Properties and Pfam Annotations
| Number of structural domains | 124 |
|---|---|
| Mean domain length (aa) | 161 ± 27 aa |
| Standard deviation of domain lengths | 27.48 |
| Length coefficient of variation | 0.17 |
| Mean AlphaFold2 pLDDT confidence score | 75.95 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.45 |
| Mean intra-cluster local Distance Difference Test score | 0.61 |
| Mean intra-cluster sequence similarity (%) | 17.08 |
| Pfam Score | 55.69 |
| Assigned Pfam label(s) | CL0257- PF21672- PF17663- CL0012- PF07258 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A5C6NUD3 | 16-167 | SVQKGLRFLADPSVYDRTSFQGLVDASFRSLLSSHGDSSVLDQPELKQVDQIQVKQSHAAATTFILEAVRHCADRSTISIGSCPPRV… |
| A0A1B0EVW2 | 4-133 | KSARSAFACLRFLLTSAVRHNTPPAIFEAELQQLGLPKEHSAGLCRTLGEFSERLQDFLNSQSLSVNELEDVHCVPSETLPDCVNLR… |
| A0A7R9XR29 | 3-141 | None |
| A0A5N5TDS6 | 47-203 | None |
| A0A803J2G9 | 98-266 | None |
| A0A7S2UZT4 | 5-156 | None |
| A0A391NJ89 | 3-202 | None |
| A0A6A4JSB3 | 160-339 | None |
| A0A147EZ67 | 1-151 | None |
| A0A498NNX4 | 145-324 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.