DPCstruct | MC51751
Metacluster Properties and Pfam Annotations
| Number of structural domains | 8 |
|---|---|
| Mean domain length (aa) | 288 ± 71 aa |
| Standard deviation of domain lengths | 71.04 |
| Length coefficient of variation | 0.25 |
| Mean AlphaFold2 pLDDT confidence score | 84.46 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.87 |
| Mean intra-cluster local Distance Difference Test score | 0.79 |
| Mean intra-cluster sequence similarity (%) | 41.66 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A5C6NPW2 | 3-349 | VAGLDYRKLTDESLDPLAALQPVLTSQNVLSISKLAHRLPVPGGGDATVSASAVHATWLQKLFWKGDPQLLKRPPQGDHDYMHAYDT… |
| A0A4Y2QDN4 | 191-422 | YKKVMSPDLSAIYLTDIVNDSNVHMFAKVASDIPKKNGVFYEPSNIYRFWAQKYFFEGNAPNSKIPTTKSEWLHRYESCSNLLQRLD… |
| A0A226MV78 | 136-574 | None |
| A0A2I0TQ90 | 443-748 | None |
| A0A822F1Z9 | 1-206 | None |
| A0A834A8M7 | 93-376 | None |
| A0A834A3N7 | 1012-1263 | None |
| A0A7R9IRT8 | 454-690 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.