DPCstruct | MC5175
Metacluster Properties and Pfam Annotations
| Number of structural domains | 116 |
|---|---|
| Mean domain length (aa) | 248 ± 48 aa |
| Standard deviation of domain lengths | 47.55 |
| Length coefficient of variation | 0.19 |
| Mean AlphaFold2 pLDDT confidence score | 73.57 |
| Mean fraction of residues predicted as intrinsically disordered | 0.31 |
| Mean length-normalized TM-Score | 0.42 |
| Mean intra-cluster local Distance Difference Test score | 0.58 |
| Mean intra-cluster sequence similarity (%) | 18.20 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF20237 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1D9QFY3 | 16-275 | GTYSQLGIYRRFSTLNARNLLYLQAELVILEADLNQFTKNDCMSEDLNAKHYQKNWYYLSERKNGVANSQYHTMLCVRQKLKEYNEC… |
| A0A559MEI6 | 164-314 | ACFMNSNDDWAIFRRFGYLSTRVLNQLQIELTDLEKELNDLDDKDAADPLMKKRLRGYEGFGGWNNSQLELLSRIRQKLSEFYDLLL… |
| A0A6A5TE51 | 9-230 | None |
| W9W120 | 31-218 | None |
| A0A423VY52 | 1-184 | None |
| A0A0F4YSU2 | 286-467 | None |
| A0A7R8A1T2 | 6-190 | None |
| A0A1L9T6L6 | 1-246 | None |
| A0A084RXL5 | 204-426 | None |
| A0A517LPT6 | 12-282 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.