DPCstruct | MC51749
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 90 ± 11 aa |
| Standard deviation of domain lengths | 11.08 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 81.37 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.52 |
| Mean intra-cluster local Distance Difference Test score | 0.85 |
| Mean intra-cluster sequence similarity (%) | 46.30 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0271 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A5C6NP66 | 2-88 | REVCSSLLQPRGIVELQWERRMCPSAPGAVSWQIKNKVWRFSTAFSPVLSWHFADVPSMSQHLAKCDFNVVEQQTEPVPLPAMSNAQ |
| A0A834BUT0 | 21-99 | RQVCFSLLHERGMVTLRWRRKTCTQGRFKWEAKPVWEFSHLFSSVDSWRQLDIPPMSAHLKVCPYYQTSTHSEPIALPS |
| A0A663MMD6 | 640-737 | None |
| A0A498MTY8 | 467-547 | None |
| A0A7R9NZX4 | 253-333 | None |
| A0A1Y3BKX9 | 1-95 | None |
| A0A151NLQ8 | 1-83 | None |
| A0A3P9N9L7 | 399-485 | None |
| A0A3Q3D3U3 | 608-722 | None |
| A0A315WD20 | 609-710 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.