DPCstruct | MC5174
Metacluster Properties and Pfam Annotations
| Number of structural domains | 16 |
|---|---|
| Mean domain length (aa) | 209 ± 37 aa |
| Standard deviation of domain lengths | 37.20 |
| Length coefficient of variation | 0.18 |
| Mean AlphaFold2 pLDDT confidence score | 80.26 |
| Mean fraction of residues predicted as intrinsically disordered | 0.28 |
| Mean length-normalized TM-Score | 0.76 |
| Mean intra-cluster local Distance Difference Test score | 0.75 |
| Mean intra-cluster sequence similarity (%) | 41.72 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0507 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| Q0U931 | 95-307 | EAEIRRQLERYAYSIEEFKAQHGCGPSEENQQTTSPDPVRSEWTHQTRKVAAYATHIMHVLHILLHGKWDPVALLEDDNMWICSQNF… |
| A0A0G4KM99 | 1-157 | MHVLHILLAGKWDPINLIDDNDLWISSQGFITATGHAVSAAEAISHILEFDPGLEFMPFFFGIYLLQGSFLLLLIADKLQLEASPSV… |
| A0A423XJS3 | 221-447 | None |
| A0A4U0X7W6 | 33-256 | None |
| A0A507QYW6 | 205-397 | None |
| A0A4Z1IJZ8 | 154-398 | None |
| A0A094HU56 | 1017-1166 | None |
| T5A7D5 | 128-359 | None |
| A0A1B8D3E0 | 393-618 | None |
| E9EA70 | 525-740 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.