DPCstruct | MC51739
Metacluster Properties and Pfam Annotations
| Number of structural domains | 9 |
|---|---|
| Mean domain length (aa) | 274 ± 20 aa |
| Standard deviation of domain lengths | 19.80 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 80.10 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.45 |
| Mean intra-cluster local Distance Difference Test score | 0.68 |
| Mean intra-cluster sequence similarity (%) | 29.63 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF10564 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2A9M8U6 | 17-280 | IPALSAFISKRKWSYCSTFQHVVDAMCKFVNSGNIGRYYPAENRWICLDAADVSLEGHSFCANNCGGIMRCAGGIAAGESPSHSGYI… |
| A0A2A9M1X6 | 111-416 | CSGGVDWQKTVHVTRHDELSTLIQETIPLFCSPYQAAANKFCQASFAGTVARKTKGFGDDDPIIWRCYEPGSLLFSIYGECISNCGH… |
| A0A0F7U3W1 | 211-473 | None |
| A0A2C6L1G2 | 1-263 | None |
| A0A2C6L209 | 9-253 | None |
| A0A1D3CVW0 | 166-471 | None |
| A0A151HGM9 | 442-702 | None |
| U6N1S2 | 91-361 | None |
| H9BC57 | 124-408 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.