DPCstruct | MC51736
Metacluster Properties and Pfam Annotations
| Number of structural domains | 86 |
|---|---|
| Mean domain length (aa) | 141 ± 24 aa |
| Standard deviation of domain lengths | 23.78 |
| Length coefficient of variation | 0.17 |
| Mean AlphaFold2 pLDDT confidence score | 82.06 |
| Mean fraction of residues predicted as intrinsically disordered | 0.24 |
| Mean length-normalized TM-Score | 0.76 |
| Mean intra-cluster local Distance Difference Test score | 0.75 |
| Mean intra-cluster sequence similarity (%) | 33.32 |
| Pfam Score | 95.68 |
| Assigned Pfam label(s) | CL0425- PF00346- CL0026 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A538MYK0 | 266-420 | LVGGVVLAPLLPGLVQHWKARLQGRRGPTPVQPYRDLRRLWGKSAVAVEGTSVVYRLAPSVVAASLGAAVLLVPVAAQAPDWGLGHD… |
| A0A6P5V7M1 | 15-145 | GVAYLTLMERKVMAAMQMRRGPNVNGLFGLLQAFADAIKMIFKETVIPAGANRALFLFAPFLTFSLAMLAWAVIPTGNGLAVANINV… |
| A0A5N5IVZ7 | 72-193 | None |
| A0A379GBP5 | 13-176 | None |
| A0A2R6AQ17 | 16-165 | None |
| A0A0M8MRX5 | 213-357 | None |
| A0A6N9Y501 | 1-137 | None |
| A0A483ADL8 | 2-104 | None |
| A0A5N5J027 | 325-455 | None |
| A0A3B4AEE5 | 2-125 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.