DPCstruct | MC51735
Metacluster Properties and Pfam Annotations
| Number of structural domains | 165 |
|---|---|
| Mean domain length (aa) | 110 ± 16 aa |
| Standard deviation of domain lengths | 16.34 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 83.29 |
| Mean fraction of residues predicted as intrinsically disordered | 0.24 |
| Mean length-normalized TM-Score | 0.57 |
| Mean intra-cluster local Distance Difference Test score | 0.54 |
| Mean intra-cluster sequence similarity (%) | 13.60 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF07752 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A9A3S5 | 20-124 | ASSQVFGQIQMIEIGFDETIDFDGIQIHFSDVDTSRCPVDGECSREQVTVIIEMDRGTLYTTSYMTLEKSTSYVKQYEIRVMDIQPW… |
| A0A812A2B1 | 162-262 | KKTLTIGETWDIGDGWTLMAQSIDAKASPRQAWLVLSKDGVKLEDEVVQNGNVFVYKKDIGGKSDVPLFVTYIDSVFAGATSDMVQL… |
| A0A1F8ZNT0 | 34-166 | None |
| A0A842V1S8 | 2-96 | None |
| A0A842VBR1 | 2-103 | None |
| A0A5E4KI01 | 45-158 | None |
| A0A2W1ABU1 | 8-137 | None |
| A0A4R1WEE6 | 79-191 | None |
| A0A2G6LS49 | 21-149 | None |
| A0A1I6JUL0 | 5-134 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.