DPCstruct | MC51730
Metacluster Properties and Pfam Annotations
| Number of structural domains | 58 |
|---|---|
| Mean domain length (aa) | 244 ± 50 aa |
| Standard deviation of domain lengths | 50.09 |
| Length coefficient of variation | 0.21 |
| Mean AlphaFold2 pLDDT confidence score | 88.46 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.67 |
| Mean intra-cluster local Distance Difference Test score | 0.61 |
| Mean intra-cluster sequence similarity (%) | 24.93 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF11376 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A523KAA1 | 261-533 | LKDSDEVIVVEINGDARAFPDLFITQPHIAGDIIGGEEVVMTYCGLSHLGIAYAPFLNGQRLDLKVMSQLENNLVMWDAVTGIPIQQ… |
| A0A7W1BSP6 | 20-252 | WHEIVNDQIARVPVAVTFCPLCNTAIVFDRRLDGDVLSFGTTGKLRESDLVMYDRKTESWWQQFSGEALVGTLAGEKLRQLSARIVS… |
| A0A6N7FIC4 | 141-347 | None |
| K9Z663 | 193-445 | None |
| A0A6N7GDN0 | 101-358 | None |
| A0A6L8E4F3 | 320-597 | None |
| A0A084U9V9 | 1-166 | None |
| W0DLC8 | 99-360 | None |
| A0A0B8NW23 | 11-264 | None |
| A0A2R6I072 | 1-195 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.