DPCstruct | MC5173
Metacluster Properties and Pfam Annotations
| Number of structural domains | 12 |
|---|---|
| Mean domain length (aa) | 554 ± 39 aa |
| Standard deviation of domain lengths | 39.32 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 66.22 |
| Mean fraction of residues predicted as intrinsically disordered | 0.49 |
| Mean length-normalized TM-Score | 0.32 |
| Mean intra-cluster local Distance Difference Test score | 0.65 |
| Mean intra-cluster sequence similarity (%) | 26.61 |
| Pfam Score | 90.00 |
| Assigned Pfam label(s) | CL0363- CL0236 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A401VYS0 | 198-801 | TENLYDADGERLIHRAADGSTTLYLGDTELTAGKDGKLATTRYYQHPDGAVTVRTAEEGDGTNGKGTLDLQLTDHHDSGTTQIGVGK… |
| A0A7Y9JZF6 | 9-567 | TTVYLPGGQELTLTTSSGELAAQRYYSFAGQTVATRTGTAASTVSSLFADTQGTALVSVQNITDAVTVRRTDPYGNVRGTNPSWPGD… |
| A0A250VUL6 | 113-740 | None |
| A0A2S0PEJ4 | 15-557 | None |
| A0A0N1GQV2 | 447-1014 | None |
| A0A5Q0GXC8 | 1-490 | None |
| A0A7K2WGH9 | 516-1010 | None |
| A0A846SGM5 | 42-598 | None |
| E6SAA0 | 86-604 | None |
| A0A4S2IVV5 | 40-591 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.