DPCstruct | MC51710
Metacluster Properties and Pfam Annotations
| Number of structural domains | 15 |
|---|---|
| Mean domain length (aa) | 259 ± 42 aa |
| Standard deviation of domain lengths | 41.75 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 78.46 |
| Mean fraction of residues predicted as intrinsically disordered | 0.35 |
| Mean length-normalized TM-Score | 0.56 |
| Mean intra-cluster local Distance Difference Test score | 0.60 |
| Mean intra-cluster sequence similarity (%) | 28.37 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0169 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1J0TV07 | 1-246 | MTVHKLNAGDGYVYLTKHVAKGDATESRKPDAVDYYLAKGTPPGIWCGKLAEKVDVEVGTEVTESAMRSVFGAARIPNALDTKPGPG… |
| A0A0M9XPK9 | 2-330 | GYATPIRAPEQVEYRLADSRDLRWVGSGLSEFGLTAGVPVDAGMARALMDGRDPNTGEQLVKRKKVLDPRGKVAAHVVVDAVRELAA… |
| A0A100I159 | 3-292 | None |
| A0A1H2DDB2 | 1-289 | None |
| K0F0E3 | 1-276 | None |
| G0PQH8 | 1-238 | None |
| A0A7I9X9U2 | 22-302 | None |
| A0A3A4KJN5 | 1-267 | None |
| A0A3N1HPA2 | 91-270 | None |
| A0A1H9SR17 | 1-196 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.