DPCstruct | MC51707
Metacluster Properties and Pfam Annotations
| Number of structural domains | 173 |
|---|---|
| Mean domain length (aa) | 127 ± 17 aa |
| Standard deviation of domain lengths | 17.08 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 85.71 |
| Mean fraction of residues predicted as intrinsically disordered | 0.34 |
| Mean length-normalized TM-Score | 0.55 |
| Mean intra-cluster local Distance Difference Test score | 0.52 |
| Mean intra-cluster sequence similarity (%) | 19.46 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0263 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0T9LTH8 | 13-137 | YIDPLGLSSCILGRNMGARTGDGMANHHLIPEELMKDKNFKSIFDRLKKIGWDGDGASNGTFLPGSKDLANTMGIPGHWSNHNQYTG… |
| A0A560DYI7 | 2-147 | FQIHHILPQALAGHFTLKVLGDRFNLNGIRNLMDLPSNEQAARELGSSPHTGGHLGSYSRIFCKFLGVLQSHPSFAAAQEGDSAAVD… |
| A0A3E0Q2E0 | 272-399 | None |
| A0A518HXP6 | 83-208 | None |
| A0A285R7J4 | 199-333 | None |
| A0A7Y4N728 | 83-220 | None |
| A0A7Y4N206 | 227-333 | None |
| A0A4R7ZIN7 | 448-563 | None |
| A0A7K0KH27 | 359-493 | None |
| A0A3D4PKY2 | 846-967 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.