DPCstruct | MC51706
Metacluster Properties and Pfam Annotations
| Number of structural domains | 8 |
|---|---|
| Mean domain length (aa) | 629 ± 65 aa |
| Standard deviation of domain lengths | 65.30 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 80.86 |
| Mean fraction of residues predicted as intrinsically disordered | 0.28 |
| Mean length-normalized TM-Score | 0.61 |
| Mean intra-cluster local Distance Difference Test score | 0.50 |
| Mean intra-cluster sequence similarity (%) | 20.68 |
| Pfam Score | 65.00 |
| Assigned Pfam label(s) | CL0323- PF11856 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| G1XXT9 | 1-709 | MLLARALAHDLDLDALTELWLDGADVTNLMVEDGRATKWSKWFLKPFLAYGLGRLMRLAPDDEMRWKLSMFVRSRWFKPPFDGMRLM… |
| A0A1W2FA37 | 73-729 | ALALAQVNPHADLNSLRELWAEQGRMDLLLRTPFKGEPVSLLKGDEFFLPRLEDAMRRLTSRYEPRDVHDRPMDLRITTTLLKGVTK… |
| A0A101JI93 | 1-621 | None |
| A0A0X3V2D9 | 17-566 | None |
| A0A5N5V9Z8 | 99-780 | None |
| A0A543HGU9 | 58-613 | None |
| A0A7J9YAL9 | 26-731 | None |
| A0A838VAI8 | 21-568 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.