DPCstruct | MC51704
Metacluster Properties and Pfam Annotations
| Number of structural domains | 196 |
|---|---|
| Mean domain length (aa) | 131 ± 28 aa |
| Standard deviation of domain lengths | 28.31 |
| Length coefficient of variation | 0.22 |
| Mean AlphaFold2 pLDDT confidence score | 86.02 |
| Mean fraction of residues predicted as intrinsically disordered | 0.28 |
| Mean length-normalized TM-Score | 0.69 |
| Mean intra-cluster local Distance Difference Test score | 0.70 |
| Mean intra-cluster sequence similarity (%) | 24.67 |
| Pfam Score | 97.96 |
| Assigned Pfam label(s) | PF00237- PF01151- PF06331- CL0229- PF00203 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A291L469 | 15-135 | RSNKIKSRQVQALARHIHMSAHKARRVIDQIRGRSYEETLMLLELMPYRASYPIFKLLYSAAANASHNRGFNEVDLYISKAEVNEGA… |
| A0CDD8 | 107-226 | IVKKVPKQEKVLISGVRRKVPASLRRLIPICRPLINMHLYQAQEAIADSGRKAAQFLAKTLVMVRSHAVQRGYDPERLYVQSIQVGR… |
| K8F385 | 1-98 | None |
| K8EDC2 | 135-286 | None |
| A0A7Y3PMX7 | 8-136 | None |
| F4Q265 | 783-906 | None |
| A0A1Q9CPH5 | 3-162 | None |
| A0A834T3M4 | 4-161 | None |
| A0A4S8MYT8 | 57-197 | None |
| A0A532E7V2 | 4-81 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.