DPCstruct | MC51700
Metacluster Properties and Pfam Annotations
| Number of structural domains | 132 |
|---|---|
| Mean domain length (aa) | 174 ± 37 aa |
| Standard deviation of domain lengths | 36.51 |
| Length coefficient of variation | 0.21 |
| Mean AlphaFold2 pLDDT confidence score | 72.92 |
| Mean fraction of residues predicted as intrinsically disordered | 0.30 |
| Mean length-normalized TM-Score | 0.50 |
| Mean intra-cluster local Distance Difference Test score | 0.57 |
| Mean intra-cluster sequence similarity (%) | 22.17 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0097 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| Q75CI5 | 2-148 | LSAEDFSDQVLRLLPLLRRWRRCEHALWDPRARRLQLSVATARNSARFDVRVDLHPLYAVPQLLLRYWEPDPAVSEYEVWKLHFVDP… |
| A0A182WFL4 | 7-183 | IVYCDQLVAASRNCRSQWRWEHEGKLSYIRLEKKQHVQGQLLDRKQCNESGMKNDFFAKETGGDPSCASVEDIASILSFEYHVLYNE… |
| A0A7N8Y867 | 6-230 | None |
| A0A7E4W0J7 | 32-176 | None |
| A0A4U0Y001 | 608-759 | None |
| A0A3N4IAF0 | 9-200 | None |
| I2H496 | 1-162 | None |
| A0A7R9PRK3 | 39-228 | None |
| A0A7S0Y8L1 | 53-206 | None |
| A0A504X1Z3 | 8-202 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.