DPCstruct | MC517
Metacluster Properties and Pfam Annotations
| Number of structural domains | 20 |
|---|---|
| Mean domain length (aa) | 62 ± 3 aa |
| Standard deviation of domain lengths | 3.18 |
| Length coefficient of variation | 0.05 |
| Mean AlphaFold2 pLDDT confidence score | 89.11 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.87 |
| Mean intra-cluster local Distance Difference Test score | 0.85 |
| Mean intra-cluster sequence similarity (%) | 42.19 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A8B2XF84 | 1-56 | MNIGDSVIMNEKYVVAEKNQGKVFTVRSQHFDICGTECVMLEGYSGGYAVDGLTVV |
| A0A124DXX4 | 74-133 | EPLEKGDRVVMHTCYEARKEKYKDKVWTVTSNPWDLCGSEVVNLEGFNGGFATEYLKKVE |
| A0A0L6JGI6 | 1-59 | None |
| A0A4Y6V289 | 44-106 | None |
| A0A6N0LII4 | 58-119 | None |
| S7WBX1 | 38-99 | None |
| A0A1R0YQ94 | 7-71 | None |
| A0A1E1VIR9 | 8-72 | None |
| F5J1A7 | 73-132 | None |
| A0A5N7WED0 | 115-179 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.